Structure of PDB 5l2l Chain A |
>5l2lA (length=72) Species: 1294386 (Saccharomyces cerevisiae YJM1574) [Search protein sequence] |
SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINED CRFGVNCKNIYCLFRHPPGRVL |
|
PDB | 5l2l Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae. |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|