Structure of PDB 5l0m Chain A

Receptor sequence

>5l0mA (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]

EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDK
TQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL

3D structure

PDB

5l0m A Structural Investigation into Oct4 Regulation by Orphan Nuclear Receptors, Germ Cell Nuclear Factor (GCNF), and Liver Receptor Homolog-1 (LRH-1).

Chain

Resolution

2.197 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	E104 S105 R112 R135 K136 R142 R162 G163 G164 R165	E22 S23 R30 R53 K54 R60 R80 G81 G82 R83	PDBbind-CN: Kd=60nM
BS02	dna	A	Y96 H97 Y98 K107 K111 V156 R157 R160 M161 R162 R165 N166 Y172	Y14 H15 Y16 K25 K29 V74 R75 R78 M79 R80 R83 N84 Y90	PDBbind-CN: Kd=60nM
BS03	ZN	A	C122 C128 C138 C141	C40 C46 C56 C59
BS04	ZN	A	C86 C89 C103 C106	C4 C7 C21 C24

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0004879	nuclear receptor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5l0m, PDBe:5l0m, PDBj:5l0m
PDBsum	5l0m
PubMed	27984042
UniProt	O00482\|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]