Structure of PDB 5l01 Chain A

Receptor sequence
>5l01A (length=283) Species: 9606 (Homo sapiens) [Search protein sequence]
TVPWFPKKISDLDHCANRVLMYGGFKDNVYRKRRKYFADLAMNYKHGDPI
PKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNI
PQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSD
PFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATC
YFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCK
QECLITTFQDVYFVSESFEDAKEKMREFTKTIK
3D structure
PDB5l01 Optimization of spirocyclic proline tryptophan hydroxylase-1 inhibitors.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H272 H277 E317 S336
Catalytic site (residue number reindexed from 1) H161 H166 E206 S225
Enzyme Commision number 1.14.16.4: tryptophan 5-monooxygenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE A H272 H277 E317 H161 H166 E206
BS02 6Z4 A Y235 P238 R257 Y264 T265 P266 H272 A309 E317 G333 S336 S337 Y124 P127 R146 Y153 T154 P155 H161 A198 E206 G222 S225 S226 MOAD: ic50=33nM
PDBbind-CN: -logKd/Ki=7.48,IC50=33nM
BindingDB: IC50=33nM
Gene Ontology
Molecular Function
GO:0004497 monooxygenase activity
GO:0004510 tryptophan 5-monooxygenase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0016714 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0046872 metal ion binding
Biological Process
GO:0002576 platelet degranulation
GO:0007623 circadian rhythm
GO:0009072 aromatic amino acid metabolic process
GO:0030279 negative regulation of ossification
GO:0035902 response to immobilization stress
GO:0042427 serotonin biosynthetic process
GO:0045600 positive regulation of fat cell differentiation
GO:0046849 bone remodeling
GO:0060749 mammary gland alveolus development
GO:1900046 regulation of hemostasis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l01, PDBe:5l01, PDBj:5l01
PDBsum5l01
PubMed28041831
UniProtP17752|TPH1_HUMAN Tryptophan 5-hydroxylase 1 (Gene Name=TPH1)

[Back to BioLiP]