Structure of PDB 5ku3 Chain A |
>5ku3A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] |
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVK LNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK PGDDIVLMAEALEKLFLQKINELPTE |
|
PDB | 5ku3 Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300. |
Chain | A |
Resolution | 1.14 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6XH |
A |
W81 L92 Y139 I146 |
W40 L51 Y98 I105 |
PDBbind-CN: -logKd/Ki=4.89,IC50=13uM BindingDB: IC50=10510nM |
|
|