Structure of PDB 5kth Chain A

Receptor sequence
>5kthA (length=143) Species: 9913 (Bos taurus) [Search protein sequence]
AELSCYSVKNCCPLKWFHFQSSCYLFSPDTMSWRASLKNCSSMGAHLVVI
NTQEEQEFLYYTKPRKKEFYIGLTDQVTEGQWQWVDGTPFTKSLSFWDAG
EPNNLVTVEDCATIRDSSNPRQNWNDVPCFFNMFRVCEMPERK
3D structure
PDB5kth Binding Sites for Acylated Trehalose Analogs of Glycolipid Ligands on an Extended Carbohydrate Recognition Domain of the Macrophage Receptor Mincle.
ChainA
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A E135 R182 E68 R115
BS02 GLC A E168 N170 E176 R182 N192 E101 N103 E109 R115 N125
BS03 CA A E168 N170 E176 N192 D193 E101 N103 E109 N125 D126
BS04 CA A V116 N118 E122 E205 V49 N51 E55 E138
BS05 CA A D142 E146 N171 E176 D177 D75 E79 N104 E109 D110
External links