Structure of PDB 5kt7 Chain A

Receptor sequence

>5kt7A (length=379) Species: 9606 (Homo sapiens)

SSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGV
KKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGF
DENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLV
GSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPES
CQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELGI
SVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELL
ASLLNRVCQDGRKPHTVRLIIRRYGRESRQCPIPSHVIQKLYDVMTPMVD
ILMKLFRNMVNVKMPFHLTLLSVCFCNLK

3D structure

• PDB: 5kt7 Kinetic and Structural Impact of Metal Ions and Genetic Variations on Human DNA Polymerase iota.
• Chain: A
• Resolution: 3.151 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q59 K60 Y61 N80 R82 L99 Q300 S301 S303 E305 S307	Q34 K35 Y36 N55 R57 L74 Q275 S276 S278 E280 S282
BS02	dna	A	E127 K207 I242 G243 K245 T246 E358 S359 R360 Q361	E102 K182 I217 G218 K220 T221 E327 S328 R329 Q330
BS03	MN	A	D34 D126 E127	D9 D101 E102
BS04	0KX	A	D34 L35 C37 F38 Y39 V64 T65 Y68 R71 K77 D126	D9 L10 C12 F13 Y14 V39 T40 Y43 R46 K52 D101
BS05	MN	A	D34 L35 D126	D9 L10 D101

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:5kt7, PDBe:5kt7, PDBj:5kt7
• PDBsum: 5kt7
• PubMed: 27555320
• UniProt: Q9UNA4|POLI_HUMAN DNA polymerase iota (Gene Name=POLI)