Structure of PDB 5kqy Chain A |
>5kqyA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLNTGADDTVIEDMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
|
PDB | 5kqy Effects of Hinge-region Natural Polymorphisms on Human Immunodeficiency Virus-Type 1 Protease Structure, Dynamics, and Drug Pressure Evolution. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
N25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|