Structure of PDB 5kql Chain A

Receptor sequence

>5kqlA (length=154) Species: 9606 (Homo sapiens)

ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGN
PPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKS
NQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFL
EKAH

3D structure

• PDB: 5kql Inhibition of low molecular weight protein tyrosine phosphatase by an induced-fit mechanism.
• Chain: A
• Resolution: 1.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C12 N15 C17 R18 S19 D129
• Catalytic site (residue number reindexed from 1): C9 N12 C14 R15 S16 D126
• Enzyme Commision number: 3.1.3.2: acid phosphatase.
  3.1.3.48: protein-tyrosine-phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6VY	A	C12 L13 G14 I16 C17 R18 Y49 D56 D129 P130 Y131 F138	C9 L10 G11 I13 C14 R15 Y46 D53 D126 P127 Y128 F135	PDBbind-CN: -logKd/Ki=4.00,IC50>100uM

Gene Ontology

Molecular Function

• GO:0003993 acid phosphatase activity
• GO:0004721 phosphoprotein phosphatase activity
• GO:0004725 protein tyrosine phosphatase activity
• GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
• GO:0005515 protein binding
• GO:0016791 phosphatase activity

Biological Process

• GO:0006470 protein dephosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0009898 cytoplasmic side of plasma membrane
• GO:0042383 sarcolemma
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:5kql, PDBe:5kql, PDBj:5kql
• PDBsum: 5kql
• PubMed: 27676368
• UniProt: P24666|PPAC_HUMAN Low molecular weight phosphotyrosine protein phosphatase (Gene Name=ACP1)