Structure of PDB 5ko6 Chain A

Receptor sequence

>5ko6A (length=285) Species: 6183 (Schistosoma mansoni)

TPVVANYENASMAADYIKRVSNVLPDIGIICGSGLGKLIEEIEERKVIPY
INIPNFPKTTVAGHVGNLVLGSVGGRKIVAMQGRLHMYEGYSNQEIALPI
RVMKLLGVRVLLITNLAGGINRKLKSGDFVLIKGHINFPGLGLNNVLVGP
NQDEFGPRFPDLSNAYDRLLQQLALKIAQENDFQDLVHEGVYAFNGGPTY
ESPDESNMLLKLGCDVVGMSTVPEVIIACHCGIKVLAVSLIANNSILDAE
NDVSINHEKVLAVAEKRADLLQMWFKEIITRLPLD

3D structure

• PDB: 5ko6 The molecular structure of Schistosoma mansoni PNP isoform 2 provides insights into the nucleoside selectivity of PNPs.
• Chain: A
• Resolution: 1.42 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S35 H66 H88 Y90 E91 L118 M221 S222 N245 S247 H259
• Catalytic site (residue number reindexed from 1): S33 H64 H86 Y88 E89 L116 M219 S220 N243 S245 H257
• Enzyme Commision number: 2.4.2.1: purine-nucleoside phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CYT	A	L118 A119 G120 Y202 E203 M221 N245	L116 A117 G118 Y200 E201 M219 N243
BS02	R1P	A	G34 S35 R86 H88 Y90 N117 L118 Y202 M221 S222 H259	G32 S33 R84 H86 Y88 N115 L116 Y200 M219 S220 H257

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004731 purine-nucleoside phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0047975 guanosine phosphorylase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0009116 nucleoside metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5ko6, PDBe:5ko6, PDBj:5ko6
• PDBsum: 5ko6
• PubMed: 30192840
• UniProt: A0A0U3AGT1