Structure of PDB 5knr Chain A

Receptor sequence
>5knrA (length=172) Species: 562 (Escherichia coli) [Search protein sequence]
MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGSFMFMA
DLCREVQVSHEVDFMTASSYGTRDVKILKDLDEDIRGKDVLIVEDIIDSG
NTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVG
YGIDYAQRYRHLPYIGKVILLD
3D structure
PDB5knr Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase
ChainA
Resolution2.864 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E103 D104 D107 F156 R169
Catalytic site (residue number reindexed from 1) E94 D95 D98 F147 R160
Enzyme Commision number 2.4.2.8: hypoxanthine phosphoribosyltransferase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 3L5 A G48 D104 I105 I106 D107 S108 G109 N110 T111 L112 K135 F156 V157 I162 G44 D95 I96 I97 D98 S99 G100 N101 T102 L103 K126 F147 V148 I153 PDBbind-CN: -logKd/Ki=5.85,Ki=1.4uM
BS02 MG A E103 D104 E94 D95
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0016757 glycosyltransferase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0052657 guanine phosphoribosyltransferase activity
GO:0097216 guanosine tetraphosphate binding
Biological Process
GO:0006166 purine ribonucleoside salvage
GO:0006178 guanine salvage
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0046100 hypoxanthine metabolic process
GO:0051289 protein homotetramerization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5knr, PDBe:5knr, PDBj:5knr
PDBsum5knr
PubMed
UniProtP0A9M2|HPRT_ECOLI Hypoxanthine phosphoribosyltransferase (Gene Name=hpt)

[Back to BioLiP]