Structure of PDB 5klu Chain A

Receptor sequence
>5kluA (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTD
ANIKKNVLWDENNMSEYLTNPAKYIPGTKMAFGGLKKEKDRNDLITYLKK
ASE
3D structure
PDB5klu Cytochrome c Can Form a Well-Defined Binding Pocket for Hydrocarbons.
ChainA
Resolution1.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A R13 C14 C17 H18 G29 P30 I35 S40 Y48 T49 W59 Y67 L68 R13 C14 C17 H18 G29 P30 I35 S40 Y48 T49 W59 Y67 L68
BS02 6UZ A N52 N62 N63 E66 Y74 N52 N62 N63 E66 Y74
BS03 HEC A F82 G83 F82 G83
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:1901612 cardiolipin binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5klu, PDBe:5klu, PDBj:5klu
PDBsum5klu
PubMed27990813
UniProtP00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)

[Back to BioLiP]