Structure of PDB 5kl9 Chain A

Receptor sequence

>5kl9A (length=134) Species: 83334 (Escherichia coli O157:H7)

MNTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHFSQQAL
MAERVAFVVRKMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAE
NTLLNEAEVLVVCVDPLKMKPRALPKSIVAEFKQ

3D structure

• PDB: 5kl9 Crystal structure of a putative acyl-CoA thioesterase EC709/ECK0725 from Escherichia coli in complex with CoA
• Chain: A
• Resolution: 2.22 Å

Enzymatic activity

• Enzyme Commision number: 3.1.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	A	H25 Y67 A68	H25 Y67 A68
BS02	COA	A	V58 V59 R60 P121	V58 V59 R60 P121

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0016790 thiolester hydrolase activity
• GO:0047617 fatty acyl-CoA hydrolase activity

Biological Process

• GO:0006629 lipid metabolic process

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:5kl9, PDBe:5kl9, PDBj:5kl9
• PDBsum: 5kl9
• UniProt: P0A8Z3|YBGC_ECOLI Acyl-CoA thioester hydrolase YbgC (Gene Name=ybgC)