Structure of PDB 5kl6 Chain A

Receptor sequence
>5kl6A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
KPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKT
HTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
3D structure
PDB5kl6 Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
ChainA
Resolution1.641 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F364 R366 R369 R372 H373 R376 R390 R394 H397 H401 T404 R424 R430 F14 R16 R19 R22 H23 R26 R40 R44 H47 H51 T54 R74 R80
BS02 dna A D396 K399 S425 D46 K49 S75
BS03 ZN A C355 C360 H373 H377 C5 C10 H23 H27
BS04 ZN A C385 C388 H401 H405 C35 C38 H51 H55
BS05 ZN A C413 C418 H431 H435 C63 C68 H81 H85
External links
PDB RCSB:5kl6, PDBe:5kl6, PDBj:5kl6
PDBsum5kl6
PubMed27596598
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]