Structure of PDB 5kgf Chain A

Receptor sequence
>5kgfA (length=101) Species: 8355 (Xenopus laevis) [Search protein sequence]
VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRF
QSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
A
3D structure
PDB5kgf The structural basis of modified nucleosome recognition by 53BP1.
ChainA
Resolution4.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K37 H39 Y41 R42 P43 R63 R72 R83 F84 Q85 R116 V117 T118 M120 K3 H5 Y7 R8 P9 R29 R38 R49 F50 Q51 R82 V83 T84 M86
BS02 dna A R40 Y41 G44 T45 V46 R49 R63 K64 L65 P66 R69 R83 R6 Y7 G10 T11 V12 R15 R29 K30 L31 P32 R35 R49
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5kgf, PDBe:5kgf, PDBj:5kgf
PDBsum5kgf
PubMed27462807
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]