Structure of PDB 5ke8 Chain A

Receptor sequence
>5ke8A (length=85) Species: 10090 (Mus musculus) [Search protein sequence]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDPLT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
3D structure
PDB5ke8 Distinctive Klf4 mutants determine preference for DNA methylation status.
ChainA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y411 K413 H416 W439 F441 R443 R449 H450 K453 R471 H474 Y13 K15 H18 W41 F43 R45 R51 H52 K55 R73 H76 PDBbind-CN: Kd<2.3nM
BS02 dna A S444 F460 S472 S46 F62 S74 PDBbind-CN: Kd<2.3nM
BS03 ZN A C462 C465 H478 H482 C64 C67 H80 H84
BS04 ZN A C432 C437 H450 H454 C34 C39 H52 H56
BS05 ZN A C402 C407 H420 H424 C4 C9 H22 H26
External links
PDB RCSB:5ke8, PDBe:5ke8, PDBj:5ke8
PDBsum5ke8
PubMed27596594
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]