Structure of PDB 5k7x Chain A

Receptor sequence

>5k7xA (length=337) Species: 70601 (Pyrococcus horikoshii OT3)

PSVIVVGGQWGDEGKGSIVAYLSLHDEPEIIARGGVGTNAGHSVVINGKK
YAVRQIPTGFMQTKARLLIGAGVLVDPEVFFHELEQLKDFNVKDRVGIDY
RCAIIEEKHKQLDRTNGYLHGKIGTTGSGCGPANADRVMRKAKQAKDVKE
LEPYLTDVAQEINDALDEGSLVLVEGTQGFGLSLYYGTYPYVTSKDVTAS
SVAADVGIGPTRVDEVIVVFKSFPTRVGAGPFPTEMPMEEADRLGLVEYG
TVTGRRRRVGWFDFEMARYSARINGATMLAVTMLDKYDKEAFGVTDYDKL
PRKAKEFIEEIEERVGVPVGLIKTGPELEHIIDRRDT

3D structure

• PDB: 5k7x Crystal structure of hypothetical adenylosuccinate synthetase, PH0438 from Pyrococcus horikoshii OT3
• Chain: A
• Resolution: 2.803 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D13 K16 G42 H43 Q179
• Catalytic site (residue number reindexed from 1): D12 K15 G41 H42 Q178
• Enzyme Commision number: 6.3.4.4: adenylosuccinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	D13 E14 G15 K16 S18 G42 H43 S44 K51 E249 R258 M284 D286 K287 K324 G326	D12 E13 G14 K15 S17 G41 H42 S43 K50 E248 R257 M283 D285 K286 K323 G325
BS02	IMP	A	D13 N40 T126 T127 Q179 L183 V193 V228	D12 N39 T125 T126 Q178 L182 V192 V227
BS03	HDA	A	D13 G42 G251 T252 V253 T254 R258	D12 G41 G250 T251 V252 T253 R257
BS04	MG	A	D13 G42	D12 G41

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004019 adenylosuccinate synthase activity
• GO:0005525 GTP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0044208 'de novo' AMP biosynthetic process
• GO:0046040 IMP metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5k7x, PDBe:5k7x, PDBj:5k7x
• PDBsum: 5k7x
• UniProt: O58187|PURA_PYRHO Adenylosuccinate synthetase (Gene Name=purA)