Structure of PDB 5k3j Chain A

Receptor sequence

>5k3jA (length=662) Species: 6239 (Caenorhabditis elegans)

NRSIRDGDNPELLEERRMATFDTDKMAAVIYGSEEFARRRREITDAVSKI
PELADIKPYPFLTREEKVTEGTRKISILTKYLNQLIDRDNEEESLHLHRE
VIGYEGHPFALHDALFIPTLQSQASDEQQEKWLERARRREIIGCYAQTEL
GHGSNLRNLETTAVYDIASQEFVLHTPTTTALKWWPGALGKSCNYALVVA
ELIIKRNNYGPHFFMVQLRDEKTHIPLKGVTVGDIGPKMNFNAADNGYLG
LNNLRVPRTNLLMRHCKVEADGTYVKPPHAKIGYSGMVKIRSQMAMEQGL
FLAHALTIAARYSAVRRQGHLDDKQVEVKVLDYQTQQHRLFPSLARAYAF
IFTGFETIHLYSQLLKDVDMGNTSGMADLHALTSGLKSVVAHETGEGIEQ
ARMACGGHGYSMASYISVVYGIAIGGCTYAGENMVMLLQLARYLVKSVEL
IKAGKAKKLGPVASYLADKSDETDLTSLNGYVKMFENMARRQAWKATEKF
LKLMESGESREVAWNKSAVELTRASRLHTRLFIIEAFMRRVSRIEDIPVK
EVLTDLLHLHVNYELLDVATYALEFMSFTQLDYVRDQLYLYLEKIRPNAV
SLVDSFQISDMQLRSVLGRRDGHVYENLFKWAKSSPLNNADVLPSVEKYL
KPMMEKAKLAAA

3D structure

• PDB: 5k3j Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
• Chain: A
• Resolution: 2.68 Å

Enzymatic activity

• Enzyme Commision number: 1.3.3.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	L113 Y147 Q149 T150 G155 S156 W187 P188 T430 Y431 E434 V437	L111 Y145 Q147 T148 G153 S154 W185 P186 T428 Y429 E432 V435
BS02	ATP	A	S390 H394 N435 M436 R525 R528 Y573	S388 H392 N433 M434 R523 R526 Y571
BS03	6QA	A	L117 Y147 S156 L158 R159 K283 Y286 M289 R293 E299 H382 Y431 A432 G433 Q441 R444	L115 Y145 S154 L156 R157 K281 Y284 M287 R291 E297 H380 Y429 A430 G431 Q439 R442
BS04	FAD	A	R318 V332 Y335 Q338 A406 G408 G409 Y412	R316 V330 Y333 Q336 A404 G406 G407 Y410
BS05	ATP	A	H340 R341 Q402 Y565	H338 R339 Q400 Y563

Gene Ontology

Molecular Function

• GO:0003997 acyl-CoA oxidase activity
• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016491 oxidoreductase activity
• GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006635 fatty acid beta-oxidation
• GO:0009058 biosynthetic process
• GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase
• GO:0055088 lipid homeostasis
• GO:1904070 ascaroside biosynthetic process

Cellular Component

• GO:0005777 peroxisome

External links

• PDB: RCSB:5k3j, PDBe:5k3j, PDBj:5k3j
• PDBsum: 5k3j
• PubMed: 27551084
• UniProt: O62137|ACX12_CAEEL Acyl-coenzyme A oxidase acox-1.2 (Gene Name=acox-1.2)