Structure of PDB 5k17 Chain A

Receptor sequence
>5k17A (length=59) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence]
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFR
HKLPDDYPI
3D structure
PDB5k17 Sequence-Dependent T:G Base Pair Opening in DNA Double Helix Bound by Cren7, a Chromatin Protein Conserved among Crenarchaea
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K24 W26 L28 A29 P30 K31 Y49 R51 K23 W25 L27 A28 P29 K30 Y48 R50 PDBbind-CN: Kd=8.82uM
BS02 dna A P30 V36 R51 H52 K53 P29 V35 R50 H51 K52 PDBbind-CN: Kd=8.82uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5k17, PDBe:5k17, PDBj:5k17
PDBsum5k17
PubMed27685992
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]