Structure of PDB 5jvo Chain A |
>5jvoA (length=79) Species: 1719 (Corynebacterium pseudotuberculosis) [Search protein sequence] |
GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVG TIAGDDTVFVLARDPMTGQELGEFLSQRR |
|
PDB | 5jvo Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
TYR |
A |
A118 D122 T132 A134 |
A37 D41 T51 A53 |
|
|
|
|