Structure of PDB 5jt4 Chain A

Receptor sequence
>5jt4A (length=125) Species: 85698 (Achromobacter xylosoxidans) [Search protein sequence]
QFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKT
LSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAG
DLDKLRAAFGDVGASCKACHDAYRK
3D structure
PDB5jt4 Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
ChainA
Resolution1.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A R12 Q13 A16 M19 A20 W56 F59 D67 K82 Q83 F86 C116 C119 H120 R124 R12 Q13 A16 M19 A20 W56 F59 D67 K82 Q83 F86 C116 C119 H120 R124
BS02 ASC A F23 H120 F23 H120
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0022900 electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jt4, PDBe:5jt4, PDBj:5jt4
PDBsum5jt4
PubMed28451315
UniProtP00138|CYCP_ALCXX Cytochrome c'

[Back to BioLiP]