Structure of PDB 5jt0 Chain A

Receptor sequence

>5jt0A (length=279) Species: 83332 (Mycobacterium tuberculosis H37Rv)

PLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVD
GLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWR
SLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRGGRV
TELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLL
IDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDS
GVGLTQFLDYTRHTWPVSLVDRPPMKVMR

3D structure

• PDB: 5jt0 Structural Snapshots and Loop Dynamics along the Catalytic Cycle of Glycosyltransferase GpgS.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.4.1.266: glucosyl-3-phosphoglycerate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D136 H258	D116 H222
BS02	UDP	A	P50 A51 L52 E54 S81 G113 K114 D134 S135 Y229 H258 R259 R261 M269	P30 A31 L32 E34 S61 G93 K94 D114 S115 Y193 H222 R223 R225 M233
BS03	XDX	A	D134 G184 R185 V186 T187 L209 S210 G211 R256 H258 N260	D114 G148 R149 V150 T151 L173 S174 G175 R220 H222 N224

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0016757 glycosyltransferase activity
• GO:0016758 hexosyltransferase activity
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006011 UDP-glucose metabolic process

External links

• PDB: RCSB:5jt0, PDBe:5jt0, PDBj:5jt0
• PDBsum: 5jt0
• PubMed: 28625787
• UniProt: P9WMW9|GPGS_MYCTU Glucosyl-3-phosphoglycerate synthase (Gene Name=gpgS)