Structure of PDB 5jqw Chain A

Receptor sequence

>5jqwA (length=365) Species: 177416 (Francisella tularensis subsp. tularensis SCHU S4)

MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTK
VNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLL
EKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQF
VIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYP
LARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFV
KGDELIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIAGLILGDTTSRKT
VMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEY
QLLQVKKLIALSEEI

3D structure

• PDB: 5jqw The crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit of Francisella tularensis subsp. tularensis SCHU S4 in complex with ADP
• Chain: A
• Resolution: 2.06 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y144 G146 E247 E259 N266 S267 K335
• Catalytic site (residue number reindexed from 1): Y144 G146 E247 E259 N266 S267 K335
• Enzyme Commision number: 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	R98 K138 G143 Y144 D145 G146 V178 E183 H206 F249 E259	R98 K138 G143 Y144 D145 G146 V178 E183 H206 F249 E259

Gene Ontology

Molecular Function

• GO:0004638 phosphoribosylaminoimidazole carboxylase activity
• GO:0005524 ATP binding
• GO:0016829 lyase activity
• GO:0016874 ligase activity
• GO:0034028 5-(carboxyamino)imidazole ribonucleotide synthase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006189 'de novo' IMP biosynthetic process

External links

• PDB: RCSB:5jqw, PDBe:5jqw, PDBj:5jqw
• PDBsum: 5jqw
• UniProt: Q5NGE8