Structure of PDB 5jph Chain A

Receptor sequence
>5jphA (length=142) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search protein sequence]
AMFSKVNNQKMLEDCFYIRKKVFVEEQGIPEESEIDEYESESIHLIGYDN
GQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGF
YVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLT
3D structure
PDB5jph Insight into the 3D structure and substrate specificity of previously uncharacterized GNAT superfamily acetyltransferases from pathogenic bacteria.
ChainA
Resolution1.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 COA A F22 D35 Y37 R59 E69 R70 V71 N105 E128 E129 F23 D36 Y38 R60 E70 R71 V72 N106 E129 E130
BS02 COA A V21 Q26 V71 A72 V73 R78 G79 G81 G83 R84 Q107 H109 P112 F113 Y114 V22 Q27 V72 A73 V74 R79 G80 G82 G84 R85 Q108 H110 P113 F114 Y115
Gene Ontology
Molecular Function
GO:0008080 N-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function
External links
PDB RCSB:5jph, PDBe:5jph, PDBj:5jph
PDBsum5jph
PubMed27783928
UniProtQ5HH30|ATSE_STAAC Acetyltransferase SACOL1063 (Gene Name=SACOL1063)

[Back to BioLiP]