Structure of PDB 5jlw Chain A

Receptor sequence
>5jlwA (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRR
MKWKKEN
3D structure
PDB5jlw Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
ChainA
Resolution2.088 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R5 T7 Y25 R31 Q50 R53 M54 R2 T4 Y22 R28 Q47 R50 M51 PDBbind-CN: Kd=3nM
BS02 dna A R5 Q6 Y8 R43 Q44 I47 N51 R2 Q3 Y5 R40 Q41 I44 N48 PDBbind-CN: Kd=3nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jlw, PDBe:5jlw, PDBj:5jlw
PDBsum5jlw
PubMed27271797
UniProtP02833|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]