Structure of PDB 5jlu Chain A |
>5jluA (length=137) Species: 301448 (Streptococcus pyogenes serotype M3) [Search protein sequence] |
GTLEKKLDNLVNTILLKAENQHDVKLTNTQEHILMLLSQQRLTNTDLAKA LNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPIASEHTH HHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG |
|
PDB | 5jlu Crystal structure of Adhesin competence repressor (AdcR) from Streptococcus pyogenes |
Chain | A |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H42 H108 H112 |
H32 H98 H102 |
|
|
|
|