Structure of PDB 5jhn Chain A

Receptor sequence

>5jhnA (length=273) Species: 9606 (Homo sapiens)

IRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNID
RNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIF
ECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFIC
EYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLC
DPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKY
FTCQCGSEKCKHSAEAIALEQSR

3D structure

• PDB: 5jhn S-adenosyl methionine is necessary for inhibition of the methyltransferase G9a by the lysine 9 to methionine mutation on histone H3.
• Chain: A
• Resolution: 1.67 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1067 Y1154
• Catalytic site (residue number reindexed from 1): Y152 Y239
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D1074 A1077 D1078 D1083 L1086 F1087 D1088 N1091 R1123 Y1154 R1157 F1158 I1161	D159 A162 D163 D168 L171 F172 D173 N176 R208 Y239 R242 F243 I246
BS02	ZN	A	C980 C1017 C1023 C1027	C65 C102 C108 C112
BS03	ZN	A	C974 C976 C980 C985	C59 C61 C65 C70
BS04	ZN	A	C974 C987 C1017 C1021	C59 C72 C102 C106
BS05	ZN	A	C1115 C1168 C1170 C1175	C200 C253 C255 C260
BS06	SAM	A	M1048 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168	M133 W135 S169 Y170 R194 F195 N197 H198 Y239 F251 C253

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5jhn, PDBe:5jhn, PDBj:5jhn
• PDBsum: 5jhn
• PubMed: 27185940
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)