Structure of PDB 5jg6 Chain A

Receptor sequence
>5jg6A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
DENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHC
PMCRQEWKFKE
3D structure
PDB5jg6 Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
ChainA
Resolution2.0013 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C23 C26 H56 C59 C4 C7 H33 C36
BS02 ZN A C34 C37 C44 H58 C15 C18 C21 H35
BS03 ZN A C51 H53 C73 C76 C28 H30 C50 C53
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
GO:0097602 cullin family protein binding
Biological Process
GO:0031145 anaphase-promoting complex-dependent catabolic process
Cellular Component
GO:0005680 anaphase-promoting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jg6, PDBe:5jg6, PDBj:5jg6
PDBsum5jg6
PubMed27259151
UniProtQ9NYG5|APC11_HUMAN Anaphase-promoting complex subunit 11 (Gene Name=ANAPC11)

[Back to BioLiP]