Structure of PDB 5jfx Chain A

Receptor sequence

>5jfxA (length=277) Species: 9606 (Homo sapiens)

MHHHHHHLVPRGSVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDK
MLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMV
FEYMRHGDLNRFLRSHGPVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVH
RDLATRNCLVGQGLVVKIGDFGLPIRWMPPESILYRKFTTESDVWSFGVV
LWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQR
EPQQRHSIKDVHARLQALAQAPPVYLD

3D structure

• PDB: 5jfx The Discovery of a Potent, Selective, and Peripherally Restricted Pan-Trk Inhibitor (PF-06273340) for the Treatment of Pain.
• Chain: A
• Resolution: 1.63 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D650 A652 R654 N655 D668 L689
• Catalytic site (residue number reindexed from 1): D152 A154 R156 N157 D170 L173
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6K4	A	L516 V524 L564 L567 F589 Y591 M592 L641 L657 G667 D668 F669	L28 V36 L76 L79 F101 Y103 M104 L143 L159 G169 D170 F171	MOAD: ic50=6nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:5jfx, PDBe:5jfx, PDBj:5jfx
• PDBsum: 5jfx
• PubMed: 27766865
• UniProt: P04629|NTRK1_HUMAN High affinity nerve growth factor receptor (Gene Name=NTRK1)