Structure of PDB 5jab Chain A

Receptor sequence
>5jabA (length=135) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
MAMVNTTTRLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHI
ARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDA
ELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD
3D structure
PDB5jab Rv2074 is a novel F420 H2 -dependent biliverdin reductase in Mycobacterium tuberculosis.
ChainA
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.3.98.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 6J4 A L23 H36 A39 V40 G41 I54 T55 G58 Q60 K61 R67 L23 H36 A39 V40 G41 I54 T55 G58 Q60 K61 R67
BS02 6J4 A M1 G78 A79 W81 M1 G78 A79 W81
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
GO:0042803 protein homodimerization activity
GO:0070967 coenzyme F420 binding
Cellular Component
GO:0005576 extracellular region
GO:0009274 peptidoglycan-based cell wall
GO:0009986 cell surface

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5jab, PDBe:5jab, PDBj:5jab
PDBsum5jab
PubMed27364382
UniProtP9WLL7|FBVR_MYCTU F420H(2)-dependent biliverdin reductase (Gene Name=Rv2074)

[Back to BioLiP]