Structure of PDB 5j6p Chain A |
>5j6pA (length=100) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] |
SQPSVFQCKKCFQIVGDSNAWVISHREYLSFTLSDAVENSVRVEDTFKRS DDGLCVYSELSCTRCNEVIGKVYNSTPIYLDDIRDMYTFSMDKLQAYQLG |
|
PDB | 5j6p Crystal Structure of Mis18(17-118) from Schizosaccharomyces pombe |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C25 C28 C79 C82 |
C8 C11 C62 C65 |
|
|
|