Structure of PDB 5j3t Chain A

Receptor sequence
>5j3tA (length=126) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
EDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIE
GTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQ
HVVGLWMFDPNDMSRIFNIVKESLLR
3D structure
PDB5j3t Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A H32 Y36 F38 Q43 W45 K47 E51 H88 Y93 I95 R97 W107 F109 H31 Y35 F37 Q42 W44 K46 E50 H87 Y92 I94 R96 W106 F108
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0170008 mRNA phosphatase activator activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006397 mRNA processing
GO:0043085 positive regulation of catalytic activity
GO:0110156 mRNA methylguanosine-cap decapping
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0098745 RNA decapping complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j3t, PDBe:5j3t, PDBj:5j3t
PDBsum5j3t
PubMed27183195
UniProtQ9P805|DCP1_SCHPO mRNA-decapping enzyme subunit 1 (Gene Name=dcp1)

[Back to BioLiP]