Structure of PDB 5j3q Chain A

Receptor sequence
>5j3qA (length=125) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
DENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEG
TFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQH
VVGLWMFDPNDMSRIFNIVKESLLR
3D structure
PDB5j3q Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
ChainA
Resolution1.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y36 F38 W45 K47 V90 Y93 R97 V103 W107 F109 Y34 F36 W43 K45 V88 Y91 R95 V101 W105 F107
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0170008 mRNA phosphatase activator activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006397 mRNA processing
GO:0043085 positive regulation of catalytic activity
GO:0110156 mRNA methylguanosine-cap decapping
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0098745 RNA decapping complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j3q, PDBe:5j3q, PDBj:5j3q
PDBsum5j3q
PubMed27183195
UniProtQ9P805|DCP1_SCHPO mRNA-decapping enzyme subunit 1 (Gene Name=dcp1)

[Back to BioLiP]