Structure of PDB 5j14 Chain A

Receptor sequence

>5j14A (length=450) Species: 685727 (Prescottella equi 103S)

PATPITTLQADGTHLVDGYGRTVLLHGVNNVDKDAPYLPAGETLTPQDID
ILVRHGFNTVRLGTSFDALMPQRGQIDEAYLDRLTGVVDALTARGMHVLL
DNHQDGLSKAWGGNGFPEWAIESRPREWEPNPGFPLYYLMPSLNAGWDEV
WGNTHGALDHLGTALGALAERVEGKPGVMGIELLNEPWPGSRFLSCFPNG
CPDFDRTYQAAMQKLTDAVRAQNPTIPVYWEPNVTWNQMMPSNLFAPPVT
PALTTADVVFAPHDYCIPSQLAIYLGLPQALRGLCVPQQDLTWSNIDAIT
ERANVPTVITSFGDGDPTVLKNTLARADERFIGWQYWHFGAGNATDPFLG
EVGRQLVRTYPQATAGEPGRMIFDADNGDFAYRFTPRAATRPTEIFVSDL
HYPDGYAVQVDGGQVTSAPGARIVTVVADGSGPVTVKINRPGSAGAEVPD

3D structure

• PDB: 5j14 Structural Insights into the Broad Substrate Specificity of a Novel Endoglycoceramidase I Belonging to a New Subfamily of GH5 Glycosidases
• Chain: A
• Resolution: 1.915 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	A	K61 H131 D133 F162 E214 Y293 Q298 Y302 D342 W365	K33 H103 D105 F134 E186 Y265 Q270 Y274 D314 W337
BS02	GAL	A	K61 F162 Y302 W365	K33 F134 Y274 W337
BS03	18C	A	P163 Y166 E214 F225 V262 N265 M267 Y293 Q298	P135 Y138 E186 F197 V234 N237 M239 Y265 Q270

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 17:17:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5j14', asym_id = 'A', title = 'Structural Insights into the Broad Substrate Spe...Belonging to a New Subfamily of GH5 Glycosidases '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5j14', asym_id='A', title='Structural Insights into the Broad Substrate Spe...Belonging to a New Subfamily of GH5 Glycosidases ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000272,0004553', uniprot = '', pdbid = '5j14', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000272,0004553', uniprot='', pdbid='5j14', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>