Structure of PDB 5izz Chain A

Receptor sequence

>5izzA (length=318) Species: 77133 (uncultured bacterium)

EVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKP
PQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQE
YVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRV
ITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAA
HTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQL
WDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGL
DGAMLVKTAKDLISKYDK

3D structure

• PDB: 5izz Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with metahydroxyphenylacetate, thermal exchange of ligand
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3HP	A	W90 Y95 R169 P171 V191 E211 I212 F239	W66 Y71 R145 P147 V167 E187 I188 F215

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 22:55:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5izz', asym_id = 'A', title = 'Crystal structure of a marine metagenome TRAP so...hydroxyphenylacetate, thermal exchange of ligand '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5izz', asym_id='A', title='Crystal structure of a marine metagenome TRAP so...hydroxyphenylacetate, thermal exchange of ligand ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0055085', uniprot = '', pdbid = '5izz', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0055085', uniprot='', pdbid='5izz', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>