Structure of PDB 5iqm Chain A

Receptor sequence

>5iqmA (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVT
ASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQS
AHFPLQVRALTVNGGATQGTIEAVISITYTYS

3D structure

PDB

5iqm Accelerating the Association of the Most Stable Protein-Ligand Complex by More than Two Orders of Magnitude.

Chain

Resolution

1.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E50 S112 H114	E38 S100 H102
BS02	peptide	A	V18 T20 T21 N22 A23 T24 V25 D26 L27 G28 D29 L30 Y31 S32 F33 T129 Q130 G131 T132 I133 E134 A135 V136 I137 S138 I139 T140 Y141	V6 T8 T9 N10 A11 T12 V13 D14 L15 G16 D17 L18 Y19 S20 F21 T117 Q118 G119 T120 I121 E122 A123 V124 I125 S126 I127 T128 Y129

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0007155	cell adhesion
GO:0007638	mechanosensory behavior
GO:0031589	cell-substrate adhesion
GO:0043709	cell adhesion involved in single-species biofilm formation

	Cellular Component
GO:0009289	pilus
GO:0009419	pilus tip

External links

PDB	RCSB:5iqm, PDBe:5iqm, PDBj:5iqm
PDBsum	5iqm
PubMed	27351462
UniProt	P08190\|FIMG_ECOLI Protein FimG (Gene Name=fimG)