Structure of PDB 5ij9 Chain A

Receptor sequence

>5ij9A (length=430) Species: 9606 (Homo sapiens)

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPGDDSFNTFFSETG
AGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH
YTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERL
SVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNE
AIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQT
NLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDP
RHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINY
QPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHW
YVGEGMEEGEFSEAREDMAALEKDYEEVGV

3D structure

• PDB: 5ij9 Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
• Chain: A
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G10 A12 D98 A99 N101 S140 T145 I171 T179 N206 Y224 N228	G10 A12 D91 A92 N94 S133 T138 I164 T172 N199 Y217 N221

Gene Ontology

Molecular Function

• GO:0003725 double-stranded RNA binding
• GO:0003924 GTPase activity
• GO:0005198 structural molecule activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0031625 ubiquitin protein ligase binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0030705 cytoskeleton-dependent intracellular transport
• GO:0051301 cell division
• GO:0071353 cellular response to interleukin-4

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0005881 cytoplasmic microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:5ij9, PDBe:5ij9, PDBj:5ij9
• PDBsum: 5ij9
• PubMed: 27046833
• UniProt: P68363|TBA1B_HUMAN Tubulin alpha-1B chain (Gene Name=TUBA1B)