Structure of PDB 5icu Chain A |
>5icuA (length=102) Species: 595536 (Methylosinus trichosporium OB3b) [Search protein sequence] |
HSFLVDASPSAKDHVAASPKLVKLRFGGGVEPAYSSISILDSTGKLVVEG AKGQADKPRELTLDAPELAVGSYVVKFRVLSSDGHIVEGKYEFTVDPHEN LY |
|
PDB | 5icu The CopC Family: Structural and Bioinformatic Insights into a Diverse Group of Periplasmic Copper Binding Proteins. |
Chain | A |
Resolution | 1.46 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H23 D105 H107 |
H1 D83 H85 |
|
|
|
|