Structure of PDB 5i9k Chain A

Receptor sequence
>5i9kA (length=123) Species: 10116 (Rattus norvegicus) [Search protein sequence]
NEVLMAFTSYATIILAKMMFLSSATAFQRLTNKDEKVERVRRAHLNDLEN
IVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGL
AFFVGYGVTLSMAYRLLRSRLYL
3D structure
PDB5i9k Dead-end complex, lipid interactions and catalytic mechanism of microsomal glutathione transferase 1, an electron crystallography and mutagenesis investigation.
ChainA
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.5.1.18: glutathione transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GSH A R38 L77 R29 L45
Gene Ontology
Molecular Function
GO:0004364 glutathione transferase activity
GO:0004602 glutathione peroxidase activity
GO:0016740 transferase activity
GO:0042802 identical protein binding
GO:0043295 glutathione binding
Biological Process
GO:0006749 glutathione metabolic process
GO:0009410 response to xenobiotic stimulus
GO:0032496 response to lipopolysaccharide
GO:0033327 Leydig cell differentiation
GO:0034635 glutathione transport
GO:0071449 cellular response to lipid hydroperoxide
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005778 peroxisomal membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5i9k, PDBe:5i9k, PDBj:5i9k
PDBsum5i9k
PubMed28801553
UniProtP08011|MGST1_RAT Microsomal glutathione S-transferase 1 (Gene Name=Mgst1)

[Back to BioLiP]