Structure of PDB 5hrh Chain A

Receptor sequence

>5hrhA (length=174) Species: 10497 (African swine fever virus)

MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDV
DLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLD
LFTALAEEKPYAIFFFTGPVSYLIRIAAALKKKNYKLNQYGLFKNQTLVP
LKITTEKELIKELGFTYRIPKKRL

3D structure

• PDB: 5hrh The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V80 C81 G82 E83 R84 K85 I124 A127 N138 Q139 Y140	V80 C81 G82 E83 R84 K85 I124 A127 N138 Q139 Y140
BS02	dna	A	R125 F165 T166 R168	R125 F165 T166 R168
BS03	DGT	A	G38 S39 R42 N48 D49 D51 F115 T117 V120 L123	G38 S39 R42 N48 D49 D51 F115 T117 V120 L123
BS04	MN	A	D49 D51	D49 D51
BS05	MN	A	D49 D51 D100	D49 D51 D100

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0044423 virion component

External links

• PDB: RCSB:5hrh, PDBe:5hrh, PDBj:5hrh
• PDBsum: 5hrh
• UniProt: P42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)