Structure of PDB 5ho1 Chain A |
>5ho1A (length=86) Species: 1288970 (Magnetospira sp. QH-2) [Search protein sequence] |
VPRGSHMNDVLVDAYNIAKDSQHVHGVHYIRGRNVGEDVHLDINIYVDAD LKVFESDLVADAIRRKIEAEVDHVRDVHVGVTPVRI |
|
PDB | 5ho1 The dual role of MamB in magnetosome membrane assembly and magnetite biomineralization. |
Chain | A |
Resolution | 2.53 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H245 D247 H283 |
H40 D42 H78 |
|
|
|