Structure of PDB 5hli Chain A |
>5hliA (length=146) Species: 1282 (Staphylococcus epidermidis) [Search protein sequence] |
QSNMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTL WEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIIT LTDNGQQQQEAVFEAISSCLPDTTEYDETKYVFEELEQTLKHLIEK |
|
PDB | 5hli Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR. |
Chain | A |
Resolution | 2.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
Q-2 S-1 |
Q1 S2 |
|
|
|
|