Structure of PDB 5hkc Chain A

Receptor sequence
>5hkcA (length=114) Species: 83331 (Mycobacterium tuberculosis CDC1551) [Search protein sequence]
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITS
NDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASL
MHEVDRGLRRVLDL
3D structure
PDB5hkc Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA
ChainA
Resolution1.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A W10 R24 P26 I48 T49 S50 P71 R72 S74 W10 R24 P26 I48 T49 S50 P71 R72 S74
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
Biological Process
GO:0006402 mRNA catabolic process
GO:0016075 rRNA catabolic process
GO:0044003 symbiont-mediated perturbation of host process
GO:0045926 negative regulation of growth
GO:0045927 positive regulation of growth
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkc, PDBe:5hkc, PDBj:5hkc
PDBsum5hkc
PubMed
UniProtP9WII3|MAZF6_MYCTU Endoribonuclease MazF6 (Gene Name=mazF6)

[Back to BioLiP]