Structure of PDB 5hk2 Chain A

Receptor sequence
>5hk2A (length=217) Species: 9606 (Homo sapiens) [Search protein sequence]
QWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAG
LDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLS
EYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGET
VVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFY
TLRSYARGLRLELTTYL
3D structure
PDB5hk2 Crystal structure of the human sigma 1 receptor.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 61V A M93 L105 F107 S117 Y120 D126 H154 E172 Y206 M92 L104 F106 S116 Y119 D125 H153 E171 Y205 PDBbind-CN: -logKd/Ki=8.59,Ki=2.6nM
BindingDB: Ki=1.7nM
Gene Ontology
Molecular Function
GO:0004985 G protein-coupled opioid receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
Biological Process
GO:0006869 lipid transport
GO:0007399 nervous system development
GO:0038003 G protein-coupled opioid receptor signaling pathway
GO:0043523 regulation of neuron apoptotic process
GO:0070207 protein homotrimerization
GO:0150052 regulation of postsynapse assembly
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005637 nuclear inner membrane
GO:0005640 nuclear outer membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0070161 anchoring junction
GO:0098794 postsynapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hk2, PDBe:5hk2, PDBj:5hk2
PDBsum5hk2
PubMed27042935
UniProtQ99720|SGMR1_HUMAN Sigma non-opioid intracellular receptor 1 (Gene Name=SIGMAR1)

[Back to BioLiP]