Structure of PDB 5hdi Chain A

Receptor sequence

>5hdiA (length=397) Species: 1773 (Mycobacterium tuberculosis)

DANTFFGAESVQDPYPLYERMRAAGSVHRIANSDFYAVCGWDAVNEAIGR
PEDFSSNLTATMTYTAEGTAKPFEMDPLGGPTHVLATADDPAHAVHRKLV
LRHLAAKRIRVMEQFTVQAADRLWVDGMQDGCIEWMGAMANRLPMMVVAE
LIGLPDPDIAQLVKWGYAATQLLEGLVENDQLVAAGVALMELSGYIFEQF
DRAAADPRDNLLGELATACASGELDTLTAQVMMVTLFAAGGESTAALLGS
AVWILATRPDIQQQVRANPELLGAFIEETLRYEPPFRGHYRHVRNATTLD
GTELPADSHLLLLWGAANRDPAQFEAPGEFRLDRAKGHISFGKGAHFCVG
AALARLEARIVLRLLLDRTSVIEAADVGGWLPSILVRRIERLELAVQ

3D structure

• PDB: 5hdi Structural characterization of CYP144A1 - a cytochrome P450 enzyme expressed from alternative transcripts in Mycobacterium tuberculosis.
• Chain: A
• Resolution: 1.54 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E214 A275 E278 S279 T280 C386 V387 G388 E395 V424
• Catalytic site (residue number reindexed from 1): E178 A239 E242 S243 T244 C348 V349 G350 E357 V386
• Enzyme Commision number: 1.14.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L121 A122 H129 R133 A275 G276 S279 P321 F322 H325 R327 W350 S378 F379 H384 C386 V387 G388 A392	L85 A86 H93 R97 A239 G240 S243 P285 F286 H289 R291 W314 S340 F341 H346 C348 V349 G350 A354

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:5hdi, PDBe:5hdi, PDBj:5hdi
• PDBsum: 5hdi
• PubMed: 27225995
• UniProt: P9WPL1|CP144_MYCTU Cytochrome P450 144 (Gene Name=cyp144)