Structure of PDB 5hbv Chain A |
>5hbvA (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] |
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPS KKPYEEVTCCSTDKCNPHPKQRPG |
|
PDB | 5hbv Structural insights into the molecular mechanisms of myasthenia gravis and their therapeutic implications. |
Chain | A |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAN |
A |
T6 A7 |
T6 A7 |
|
|
|
|