Structure of PDB 5h0o Chain A |
>5h0oA (length=92) Species: 447909 (Geobacillus virus E2) [Search protein sequence] |
NDKEYDKHKRNQQARAFYHSREWERTRLAVLAKDNYLCQHCLKEKKITRA VIVDHITPLLVDWSKRLDMDNLQSLCQACHNRKTAEDKRRYG |
|
PDB | 5h0o Structural and functional characterization of deep-sea thermophilic bacteriophage GVE2 HNH endonuclease. |
Chain | A |
Resolution | 1.53 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
C76 C79 C114 C117 |
C38 C41 C76 C79 |
|
|
|
|