Structure of PDB 5gwt Chain A

Receptor sequence
>5gwtA (length=243) Species: 1428 (Bacillus thuringiensis) [Search protein sequence]
KIIMISGANSGIGHACIKYFLEKSFHVIALDINNNNLIDYMKTDMPLKVV
QIDLSNSEAIHNLFTQLDLEKLSPDILINAAGIREITPVLHLSDDMFKKV
IDVNLVAPFILSREVAKRWCESKIKGCIVNIASVSGLMAKPERAAYVASK
HALIGLTKQMAMEFGKQNIRVNSISPGVIRTELTEEYFSNKALMSMIKSN
QSLDTWGLPQDIVSCIEYLISDQARFITGSNFVIDGGQTAGKN
3D structure
PDB5gwt Engineering a short-chain dehydrogenase/reductase for the stereoselective production of (2S,3R,4S)-4-hydroxyisoleucine with three asymmetric centers.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NAD A G11 S14 G15 I16 D35 I36 I56 D57 L58 A84 A85 G86 I87 V107 I135 S137 Y150 K154 P180 G181 I183 T185 L187 T188 G7 S10 G11 I12 D31 I32 I52 D53 L54 A80 A81 G82 I83 V103 I131 S133 Y146 K150 P176 G177 I179 T181 L183 T184
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 07:01:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5gwt', asym_id = 'A', title = 'Engineering a short-chain dehydrogenase/reductas...hydroxyisoleucine with three asymmetric centers. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5gwt', asym_id='A', title='Engineering a short-chain dehydrogenase/reductas...hydroxyisoleucine with three asymmetric centers. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '5gwt', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='5gwt', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>