Structure of PDB 5gqo Chain A |
>5gqoA (length=97) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] |
ETPFTVVGNIITNPVRLRFGDQELYKFRVASNSLYVTVNCWGNLARGVSA SLGKGDSVVVVGHLYTNEYERSSVEVRATAVGPDLSRCIARVEKVQP |
|
PDB | 5gqo Structure of the second Single Stranded DNA Binding protein (SSBb) from Mycobacterium smegmatis. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
N17 P18 |
N13 P14 |
|
|
|
|