Structure of PDB 5gmv Chain A

Receptor sequence

>5gmvA (length=120) Species: 9606 (Homo sapiens) [Search protein sequence]

KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLV
PDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKD
EDGFLYMVYASQETFGMKLS

3D structure

PDB

5gmv Structural insights into the recognition of phosphorylated FUNDC1 by LC3B in mitophagy

Chain

Resolution

2.25 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D19 I23 K49 K51 F52 L53 P55 I66 R70 F108	D15 I19 K45 K47 F48 L49 P51 I62 R66 F104

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0008429	phosphatidylethanolamine binding
GO:0031625	ubiquitin protein ligase binding
GO:0097001	ceramide binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0000422	autophagy of mitochondrion
GO:0000423	mitophagy
GO:0006914	autophagy
GO:0006995	cellular response to nitrogen starvation
GO:0009267	cellular response to starvation
GO:0016236	macroautophagy
GO:0097352	autophagosome maturation

	Cellular Component
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005776	autophagosome
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005930	axoneme
GO:0012505	endomembrane system
GO:0016020	membrane
GO:0031090	organelle membrane
GO:0031410	cytoplasmic vesicle
GO:0031966	mitochondrial membrane
GO:0043231	intracellular membrane-bounded organelle

External links

PDB	RCSB:5gmv, PDBe:5gmv, PDBj:5gmv
PDBsum	5gmv
PubMed	27757847
UniProt	Q9GZQ8\|MLP3B_HUMAN Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=MAP1LC3B)