Structure of PDB 5g6o Chain A

Receptor sequence

>5g6oA (length=362) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEE
LEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETAT
NNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSL
TAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPD
IEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLAD
EKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVD
HHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIV
KPNYFYQDKPYE

3D structure

• PDB: 5g6o Targeting Bacterial Nitric Oxide Synthase with Aminoquinoline-Based Inhibitors.
• Chain: A
• Resolution: 1.719 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C66 R69 W238 E243
• Catalytic site (residue number reindexed from 1): C65 R68 W237 E242
• Enzyme Commision number: 1.14.14.47: nitric-oxide synthase (flavodoxin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	W60 R65 C66 F235 N236 G237 W238 E243 W329 Y355 Y357	W59 R64 C65 F234 N235 G236 W237 E242 W328 Y354 Y356
BS02	8VJ	A	H128 I218 W238 E243	H127 I217 W237 E242
BS03	8VJ	A	R247 T328 W329	R246 T327 W328

Gene Ontology

Molecular Function

• GO:0004517 nitric-oxide synthase activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006809 nitric oxide biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:5g6o, PDBe:5g6o, PDBj:5g6o
• PDBsum: 5g6o
• PubMed: 27607918
• UniProt: O34453|NOSO_BACSU Nitric oxide synthase oxygenase (Gene Name=nos)